PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN17711.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 307aa    MW: 35144.3 Da    PI: 6.5983
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN17711.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.6e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed++l ++++ +G g+W+  +++ g++R++k+c++rw++yl
       KHN17711.1 14 RGAWTAHEDKILREYIRVHGEGRWRNLPKRAGLKRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding53.26.7e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ +++E+el+++++k+lG++ W++Ia +++ gRt++++k++w++ 
       KHN17711.1  67 RGNISPDEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 111
                      7899******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-23564IPR009057Homeodomain-like
PROSITE profilePS5129417.246961IPR017930Myb domain
SuperFamilySSF466893.06E-2812108IPR009057Homeodomain-like
SMARTSM007171.2E-131363IPR001005SANT/Myb domain
PfamPF002492.1E-141461IPR001005SANT/Myb domain
CDDcd001672.34E-101661No hitNo description
PROSITE profilePS5129425.4262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2465116IPR009057Homeodomain-like
SMARTSM007175.3E-1666114IPR001005SANT/Myb domain
PfamPF002494.1E-1567112IPR001005SANT/Myb domain
CDDcd001678.79E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MGRSPCCSKE GLNRGAWTAH EDKILREYIR VHGEGRWRNL PKRAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI SPDEEELIIR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNT NLGKKVKDGH  120
QTTTGNNTQN PMPNPSPSLS PPKLDSHVVR TKATKCSKLL FLNPPPHPSM QNKFKTEAEE  180
EEEEARLVNG VIRNQMEHTT YDNGFLSFPD EEKELSTDLL IDFNVGDFCL SDLLNSDFSN  240
SYNFSCNINN VNNHEQLSPC SDQPDPMFSD EVLKDWTHNN FADEANASNN LRSFISFLES  300
TEERLGE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003550620.10.0PREDICTED: transcription factor TT2-like
SwissprotQ9FJA26e-63TT2_ARATH; Transcription factor TT2
TrEMBLA0A0B2Q7T80.0A0A0B2Q7T8_GLYSO; Transcription factor TT2
TrEMBLK7MK110.0K7MK11_SOYBN; Uncharacterized protein
STRINGGLYMA17G05831.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.13e-61MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]